PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002701G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 261aa    MW: 27787.7 Da    PI: 4.6294
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002701G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.83.8e-23171215145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRC+r++++++k+C+rH+hrgr+r  + ++e
  PH01002701G0020 171 EPEPGRCRRTDGKKWRCWRNAIPNEKYCQRHMHRGRKRPVQLVVE 215
                      69************************************9998875 PP

2QLQ54.34e-19105140237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  PH01002701G0020 105 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 140
                      8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-8104140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.922105140IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.0E-12105139IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.294171215IPR014977WRC domain
PfamPF088793.1E-19172210IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MAAEGEAKKD TNPPGGGGDN PKEAAEEATQ EAGGQEAGQE QEEEEGEKAD REGKDGDAGK  60
EEEKEENACK DLVLVEDPEE AAASAALQEE MKALVASVPV GAGAAFTAMQ LQELEQQSRV  120
YQYMAARVPV PTHLVFPIWK SVTGASSEGA QKYPTLMGLA TLCLDFGKNP EPEPGRCRRT  180
DGKKWRCWRN AIPNEKYCQR HMHRGRKRPV QLVVEDDEPD SASGSKSASG KATEGGKKTD  240
DKSSSSKKLA VAAPAAVEST *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0991680.0FP099168.1 Phyllostachys edulis cDNA clone: bphylf034g02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657676.11e-137PREDICTED: growth-regulating factor 11
SwissprotQ6AWX81e-136GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLW5BPI91e-141W5BPI9_WHEAT; Uncharacterized protein
STRINGOB07G19720.11e-136(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.18e-30growth-regulating factor 5